PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00069.1.g00120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 359aa    MW: 38064.6 Da    PI: 6.724
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00069.1.g00120.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.86.1e-192671147
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                  +g+WT+eEdell  av+++G ++W+ I ++++ gR++k+c++rw + 
  Zmw_sc00069.1.g00120.1.am.mk 26 KGSWTPEEDELLRSAVARHGARSWTVIGAEVP-GRSGKSCRLRWCNQ 71
                                  799*****************************.***********985 PP

2Myb_DNA-binding53.45.9e-1778122147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   r ++T++Ed  +v a++++G++ W+tIar +  gRt++++k++w++ 
  Zmw_sc00069.1.g00120.1.am.mk  78 RRAFTPDEDAVIVAAHARYGNK-WATIARLLH-GRTDNSVKNHWNST 122
                                   678*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.4712176IPR017930Myb domain
SuperFamilySSF466891.04E-2824119IPR009057Homeodomain-like
SMARTSM007171.0E-152574IPR001005SANT/Myb domain
PfamPF002499.2E-192671IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-232779IPR009057Homeodomain-like
CDDcd001677.89E-152870No hitNo description
SMARTSM007171.6E-1377125IPR001005SANT/Myb domain
PROSITE profilePS5129420.45778127IPR017930Myb domain
PfamPF002491.0E-1378122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-2280125IPR009057Homeodomain-like
CDDcd001671.96E-1080123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MVVPGVDGGG GSTTTTRSPT SGPRVKGSWT PEEDELLRSA VARHGARSWT VIGAEVPGRS  60
GKSCRLRWCN QLSPGVERRA FTPDEDAVIV AAHARYGNKW ATIARLLHGR TDNSVKNHWN  120
STLRRQRRAA AAAAAGCAVT PSRVEAPPPL LALVDLKDET APVPFQPQAD PKVEKNKDVY  180
DDEEEEDDDE GDGSSEDSVL APPPKKRPCV VGNHNKLPLP LHLAAKQPPV GQTKPPHPSA  240
PAGTEPVVTS LTLSLPGGGS VDPAPTSSPQ TVTSTTAAAT NETAGKEEGP AKTRARIIEE  300
DSWLLPVMRR MIVEEVHRVM GMMQPPPGLA FSFVAEPAGR SSAAAGTDDR AATNSRRDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-33251263104C-Myb DNA-Binding Domain
1mse_C1e-33251263104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439611.11e-83hypothetical protein SORBIDRAFT_09g016570
TrEMBLC5YWC01e-83C5YWC0_SORBI; Putative uncharacterized protein Sb09g016570
STRINGSb09g016570.13e-83(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154